CookSnap is coming soon — Join the waitlist →
Back to recipes

Baked Cheese & Spinach Burek

Crispy phyllo pastry layered with spinach, feta, and eggs—a Balkan classic made on a sheet pan. Golden, flaky, and ready in under an hour.

Total time
50 min
Servings
4
Calories
385
Protein
16g
Baked Cheese & Spinach Burek
comfortrusticbalkanvegetarianeggscheesecrispyflaky

Ingredients

  • 10 oz frozen spinach, thawed and squeezed dry
  • 1.5 cups feta cheese, crumbled
  • 3 whole eggs
  • 8 sheets phyllo dough sheets
  • 5 tbsp butter, melted
  • ½ tsp salt
  • ¼ tsp black pepper

Instructions

  1. 1

    Preheat oven to 375°F. Line a 9x13-inch baking sheet with parchment paper.

  2. 2

    Mix thawed spinach, crumbled feta, 2 beaten eggs, salt, and pepper in a bowl until combined.

  3. 3

    Whisk remaining egg in a small bowl with 1 tbsp water to make an egg wash.

  4. 4

    Brush one phyllo sheet with melted butter; place on baking sheet.

  5. 5

    Repeat with 3 more phyllo sheets, brushing each with butter, stacking as you go.

  6. 6

    Spread spinach-feta mixture evenly over phyllo stack.

  7. 7

    Layer remaining 4 phyllo sheets on top, brushing each with butter between layers.

  8. 8

    Brush top phyllo sheet with egg wash until glossy.

  9. 9

    Bake until phyllo is deep golden brown and crispy, 25–30 minutes.

  10. 10

    Cool for 5 minutes. Cut into squares and serve warm.

Tools you’ll need

  • 9x13-inch baking sheet
  • parchment paper
  • mixing bowl
  • whisk
  • small bowl
  • pastry brush
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.