CookSnap is coming soon — Join the waitlist →

Autumn Harvest Bowl

Roasted seasonal vegetables and crispy chickpeas over fluffy farro with a warm maple-tahini dressing. A hearty, colorful vegetarian bowl that celebrates fall flavors in under 45 minutes.

Total time
40 min
Servings
2
Calories
520
Protein
16g
Autumn Harvest Bowl
wholesomecozyamericanvegetarianchickpeascrispyfluffytender

Ingredients

  • ¾ cup farro
  • 1 can (15 oz) canned chickpeas, drained and patted dry
  • 1 small (about 1 lb) acorn squash, peeled and cubed
  • ½ lb Brussels sprouts, halved
  • 3 tablespoons, divided olive oil
  • 2 tablespoons tahini
  • 1 tablespoon maple syrup
  • 1 to taste salt and pepper

Instructions

  1. 1

    Set the oven to 425°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Spread 1.5 tablespoons of olive oil evenly across a large baking sheet by tilting and rubbing it with your hand.

  3. 3

    Pour the drained chickpeas onto the oiled baking sheet, sprinkle lightly with salt and pepper, then roll them around so they are evenly coated with oil.

  4. 4

    Add the squash cubes and Brussels sprout halves to the same baking sheet, drizzle with the remaining 1.5 tablespoons of olive oil, and sprinkle generously with salt and pepper.

  5. 5

    Toss everything on the baking sheet together by stirring and turning with a wooden spoon until each piece looks coated with oil and seasoning.

  6. 6

    Slide the baking sheet into the preheated oven and roast for 25 to 30 minutes, until the squash is fork-tender and the chickpeas look golden and crispy.

  7. 7

    Meanwhile, bring a medium pot of salted water to a boil over high heat — you should see large bubbles breaking the surface constantly, about 8 minutes.

  8. 8

    Pour the farro into the boiling water and stir once to separate any clumps, then reduce the heat to medium-low so only small bubbles occasionally break the surface.

  9. 9

    Simmer uncovered for 20 to 25 minutes, stirring once every 5 minutes, until the farro is tender but still chewy with a tiny firm center.

  10. 10

    Drain the farro in a fine-mesh strainer, shaking it several times to remove excess water, then transfer it to a large bowl.

  11. 11

    Whisk together the tahini and maple syrup in a small bowl, then add 3 tablespoons of water and whisk again until the mixture is smooth and pourable like salad dressing.

  12. 12

    Divide the cooked farro evenly between two bowls, placing it in a mound in the center of each.

  13. 13

    Top each farro mound with half of the roasted chickpeas, squash, and Brussels sprouts, arranging them in clusters around the bowl.

  14. 14

    Drizzle 2 to 3 tablespoons of the tahini-maple dressing over the top of each bowl, letting it pool slightly around the vegetables.

Tools you’ll need

  • large baking sheet
  • wooden spoon
  • medium pot
  • fine-mesh strainer
  • large bowl
  • small bowl
  • whisk
  • measuring cups and spoons

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.