CookSnap is coming soon — Join the waitlist →
Back to recipes

Austrian Beef & Pancake Soup with Roasted Potatoes

Clear beef broth with crispy pancake strips, creamy chive sauce, and golden roasted potatoes — a cozy Austrian classic that feels fancy but cooks in 25 minutes.

Total time
25 min
Servings
2
Calories
425
Protein
22g
Austrian Beef & Pancake Soup with Roasted Potatoes
comfortelegantaustrianbeefcrispytendercreamyweeknight

Ingredients

  • 4 cups beef broth
  • ½ cup all-purpose flour
  • 2 whole eggs
  • 12 oz baby potatoes
  • ¼ cup sour cream
  • 2 tbsp fresh chives
  • 3 oz deli roast beef, shredded
  • ½ tbsp whole grain mustard

Instructions

  1. 1

    Halve potatoes lengthwise, toss with oil, salt, and pepper. Spread on a sheet pan and roast at 425°F for 15 minutes until golden.

  2. 2

    Whisk flour into eggs until smooth. Heat 1 tbsp oil in a nonstick skillet over medium-high until shimmering.

  3. 3

    Pour batter in a thin stream to form a crepe-like pancake, tilting the pan to spread evenly. Cook 60 seconds until just set.

  4. 4

    Slide onto a cutting board and slice into 0.5-inch strips when cool enough to handle.

  5. 5

    Heat broth in a pot until steaming. Stir sour cream and mustard together, then whisk into broth until smooth.

  6. 6

    Divide pancake strips and roasted potatoes between bowls. Pour hot broth into each, top with shredded beef and chives. Serve immediately.

Tools you’ll need

  • sheet pan
  • nonstick skillet (10-inch)
  • pot (3-quart)
  • whisk
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.