CookSnap is coming soon — Join the waitlist →

Arepa Reina Pepiada

Crispy golden arepas stuffed with a creamy chicken and avocado filling—Venezuela's beloved street food. Ready in under 30 minutes with simple ingredients.

Total time
28 min
Servings
2
Calories
612
Protein
38g
Arepa Reina Pepiada
comfortcasualvenezuelanchickencrispycreamytenderweeknight

Ingredients

  • 1.5 cups pre-cooked shredded chicken breast
  • 1 cup arepa flour (masarepa or similar)
  • ¾ cup warm water
  • 1 whole ripe avocado
  • ¼ cup mayonnaise
  • 1 pinch salt and pepper to taste

Instructions

  1. 1

    Pour 1 cup of arepa flour into a large mixing bowl, then add 0.75 cup of warm water and 1 pinch of salt.

  2. 2

    Mix with a wooden spoon, stirring in one direction for 1 minute, until the dough is smooth and feels like soft Play-Doh with no lumps or dry flour visible.

  3. 3

    Let the dough rest in the bowl, uncovered, for 5 minutes so the flour absorbs the water completely.

  4. 4

    Cut the avocado lengthwise around the pit, twist the two halves apart, scoop out the pit, and use a spoon to scoop the flesh into a medium bowl.

  5. 5

    Add 1.5 cups of shredded chicken and 0.25 cup of mayonnaise to the avocado, then mash everything together with a fork until chunky-creamy, about 30 seconds.

  6. 6

    Taste the filling and sprinkle in salt and pepper until it tastes savory and bright.

  7. 7

    Divide the dough into 4 equal portions, then roll each one between your palms into a ball about the size of a golf ball.

  8. 8

    Flatten each ball into a thick disk about 3 inches wide and 0.5 inches thick by pressing it between the heels of your hands.

  9. 9

    Pour 0.25 inch of neutral oil into a 10-inch skillet and heat over medium-high heat until the oil shimmers and moves quickly when you tilt the pan, about 90 seconds.

  10. 10

    Slide 2 arepa disks into the hot oil and fry for 3 minutes until the bottom surface turns golden honey-brown, then flip and fry the other side for 3 minutes until equally brown.

  11. 11

    Remove the cooked arepas to a paper towel-lined plate using a slotted spatula, then repeat with the remaining 2 disks in the same oil.

  12. 12

    Once all arepas are cool enough to hold, use a small sharp knife to slice each one horizontally about 1 inch from the top, cutting parallel to the board, creating a small pocket.

  13. 13

    Spoon 2 tablespoons of the chicken-avocado filling into the pocket of each arepa, dividing the filling evenly among the 4 arepas, and serve immediately.

Tools you’ll need

  • large mixing bowl
  • wooden spoon
  • medium mixing bowl
  • fork
  • 10-inch skillet
  • paper towels
  • slotted spatula
  • small sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.