CookSnap is coming soon — Join the waitlist →
Back to recipes

Appam with Chicken & Vegetable Stew

Crispy, lacy appam pancakes paired with a fragrant coconut-spiced stew of chicken and potatoes. A showstopping South Indian meal that's easier than it looks.

Total time
75 min
Servings
4
Calories
520
Protein
32g
Appam with Chicken & Vegetable Stew
comfortwholesomeindianchickencrispycreamytenderweekend

Ingredients

  • 1 cup rice
  • ½ cup coconut, fresh grated or frozen
  • ½ tsp active dry yeast
  • 1 tbsp sugar
  • ½ tsp salt
  • 1.5 lb boneless chicken thighs
  • 1 large onion
  • 1.5 tbsp ginger-garlic paste
  • 1 can (13.5 oz) coconut milk
  • ¾ lb potatoes, waxy
  • 2 medium carrots
  • ¾ tsp cumin seeds
  • ½ tsp turmeric powder
  • ½ tsp red chili powder
  • ¼ cup coriander leaves, fresh
  • 3 tbsp olive oil

Instructions

  1. 1

    Soak rice in water for 30 minutes, then drain and grind to a fine paste with coconut and 0.25 cup water.

  2. 2

    Mix rice-coconut paste with yeast, sugar, and salt in a bowl. Cover and let rise at room temperature 6–8 hours until bubbly and risen by half.

  3. 3

    Cut chicken into 1.5-inch chunks. Dice onion. Cube potatoes and carrots into 0.75-inch pieces.

  4. 4

    Heat oil in a large pot over medium-high. Add cumin seeds and let them crackle, ~30 seconds.

  5. 5

    Add onion and cook, stirring often, until translucent and softened, ~5 minutes.

  6. 6

    Stir in ginger-garlic paste and cook until fragrant, ~1 minute.

  7. 7

    Add chicken chunks and cook without stirring for 3 minutes, then stir and cook 3 more minutes until edges turn opaque.

  8. 8

    Add turmeric and chili powder. Stir for 30 seconds until the spices coat everything.

  9. 9

    Pour in coconut milk and add 1 cup water. Add potatoes, carrots, and 0.75 tsp salt.

  10. 10

    Bring to a boil, then reduce heat to low. Cover and simmer for 25–30 minutes until potatoes are tender.

  11. 11

    Stir in fresh coriander. Taste and adjust salt and spice to preference.

  12. 12

    Heat an appam pan or 8-inch non-stick skillet over medium-high until very hot, ~2 minutes.

  13. 13

    Add 0.75 tsp oil to the pan. Pour 0.5 cup batter into the center; quickly tilt and rotate the pan to spread the batter thin across the surface.

  14. 14

    Cover and cook for 2 minutes until edges turn golden and the surface looks lacy and set but still pale in the center.

  15. 15

    Uncover and cook 1 more minute until edges crisp and lift easily. Slide onto a plate.

  16. 16

    Repeat with remaining batter. Appam should have crispy, lacy edges and a soft, creamy center.

  17. 17

    Arrange warm appam on plates. Ladle hot stew and its rich sauce into the center of each appam. Serve immediately.

Tools you’ll need

  • grinder or food processor
  • large mixing bowl
  • large heavy-bottomed pot with lid
  • appam pan (8-inch) or 8-inch non-stick skillet with lid
  • wooden spoon
  • measuring cups and spoons
  • cutting board and knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.