CookSnap is coming soon — Join the waitlist →

Air Fryer Grilled Cheese

Crispy golden bread with melted cheese in minutes—no stovetop needed. Use your favorite cheese and add optional extras like tomato or ham for variety.

Total time
8 min
Servings
1
Calories
380
Protein
12g
Air Fryer Grilled Cheese
comfortquickamericanvegetariancrispymeltyweeknightlunch

Ingredients

  • 2 slices white or wheat bread
  • 2 slices cheddar or American cheese
  • 1 tablespoon butter, softened
  • ¼ teaspoon salt
  • 0.1 teaspoon black pepper

Instructions

  1. 1

    Set the air fryer to 375°F and wait until the indicator light or beep signals it has finished preheating, about 3 minutes.

  2. 2

    Spread 0.5 tablespoon of softened butter on one side of each bread slice using a butter knife, coating the surface evenly.

  3. 3

    Place one slice butter-side down on the cutting board, then lay both cheese slices flat on top of it.

  4. 4

    Place the second bread slice on top, butter-side up, pressing down gently so the sandwich holds together.

  5. 5

    Sprinkle the top with a pinch of salt and pepper, then place the sandwich in the air fryer basket.

  6. 6

    Cook at 375°F for 5 minutes until the bread is golden brown and the cheese is melted inside when you gently squeeze the sandwich.

  7. 7

    Remove the sandwich with tongs and place it on a plate, then let it cool for 1 minute before eating so the cheese sets.

Tools you’ll need

  • air fryer
  • butter knife
  • cutting board
  • tongs
  • plate

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.