CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Air Fryer Avocado Fries

Crispy golden avocado wedges with a panko crust, ready in under 10 minutes. Serve with lime crema for a addictive snack that tastes like fried gold.

Total time
8 min
Servings
2
Calories
285
Protein
6g
Air Fryer Avocado Fries
indulgentcasualvegetariancrispycreamysnackappetizersnack

Ingredients

  • 2 whole ripe avocados
  • ¾ cup panko breadcrumbs
  • 1 whole egg
  • 1 whole lime
  • 1 pinch salt and black pepper

Instructions

  1. 1

    Cut avocados in half lengthwise, remove the pit, then cut each half into 3 long wedges.

  2. 2

    Beat egg in a shallow bowl. Spread panko in another shallow bowl.

  3. 3

    Dip each avocado wedge in egg, then roll in panko to coat all sides evenly.

  4. 4

    Place wedges in a single layer in the air fryer basket, skin-side down.

  5. 5

    Air fry at 380°F for 5 minutes until the panko is golden and crispy.

  6. 6

    Squeeze lime juice over the fries and season with salt and pepper.

  7. 7

    Serve immediately while the crust is still crispy.

Tools you’ll need

  • air fryer basket
  • shallow bowls (2)
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.