Custrd is out on the App Store — Download it free →
Back to recipes

Adobo Flakes

A quick, savory Filipino-style dish of flaked fish simmered in a tangy soy-vinegar sauce with dried vegetables and spices. Ready in about 20 minutes, perfect for breakfast or a speedy dinner.

Total time
20 min
Servings
4
Calories
180
Protein
28g
Adobo Flakes
comfortingFilipinogluten-freedairy-freefishflakyweeknightmain

Ingredients

  • 1 lb cooked white fish fillets
  • ¼ cup soy sauce
  • ¼ cup white vinegar
  • 2 leaf dried bay leaves
  • 1 tbsp dried curry leaves
  • 1 tsp black peppercorns

Instructions

  1. 1

    In a skillet over medium heat, combine 1/4 cup soy sauce, 1/4 cup white vinegar, 2 bay leaves, 1 tbsp curry leaves, and 1 tsp peppercorns. Bring to a simmer, about 2 minutes.

  2. 2

    Add 1 lb cooked white fish fillets, breaking them into large flakes with a spoon. Stir gently to coat with the sauce.

  3. 3

    Cook over medium-low, stirring occasionally, until the liquid reduces and the fish is heated through, about 8-10 minutes. The sauce should cling to the flakes and look slightly glossy.

  4. 4

    Remove from heat and serve hot with rice or as a filling for tacos. Garnish with extra curry leaves if desired.

Tools you’ll need

  • skillet
  • spoon
  • measuring cups
  • measuring spoons

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.