5-Minute Tuna Melt
Canned tuna mixed with mayo, piled on an English muffin, topped with melty cheddar, and broiled until golden. Ready in under 5 minutes.
- Total time
- 5 min
- Servings
- 2
- Calories
- 320
- Protein
- 26g
comfortquickamericanfishcrispymeltyweeknightlunch
Ingredients
- 1 5-oz can canned tuna, drained
- 2.5 tbsp mayonnaise
- 1 whole muffin English muffins, split
- ½ cup cheddar cheese, sliced or shredded
Instructions
- 1
Mix drained tuna with mayonnaise in a bowl until well combined.
- 2
Place muffin halves on a small baking sheet, cut-side up.
- 3
Divide tuna mixture evenly between the two muffin halves, spreading it on top.
- 4
Top each muffin with cheddar cheese, pressing gently so it sticks.
- 5
Broil 4–6 inches from the heat until cheese melts and edges are golden, 2–3 minutes.
Tools you’ll need
- small mixing bowl
- baking sheet
- oven broiler
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
