5-Min Nutella Cookie Bites
Soft, chewy cookie dough bites with melty Nutella centers, zero baking required. Ready in 5 minutes—the easiest TikTok dessert.
- Total time
- 5 min
- Servings
- 12
- Calories
- 165
- Protein
- 2g
indulgentsimpleitalianvegetarianchewycreamygooeydessert
Ingredients
- ½ cup all-purpose flour
- 3 tbsp butter, softened
- ¼ cup brown sugar
- ½ cup Nutella
- 1 whole egg
- ½ tsp vanilla extract
Instructions
- 1
Mix butter, brown sugar, and vanilla in a bowl until smooth and pale.
- 2
Add egg and beat until combined, then fold in flour until no dry streaks remain.
- 3
Scoop 1 tbsp dough, flatten on your palm, add 0.5 tsp Nutella in the center.
- 4
Fold dough over to seal, roll into a ball, and place on a plate.
- 5
Chill in the freezer for 3 minutes until the centers are set and the outside softens.
- 6
Serve cold or at room temperature. The dough stays chewy and the Nutella stays gooey.
Tools you’ll need
- mixing bowl
- spoon or spatula
- measuring cups and spoons
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
