CookSnap is in beta — Get it free on TestFlight →
Back to recipes

5-Min Berry Pavlova Nests

No-bake pavlova shells with whipped cream and fresh berries—ready in minutes. Crispy meringue nests that feel fancy but require zero baking.

Total time
5 min
Servings
4
Calories
245
Protein
2g
5-Min Berry Pavlova Nests
elegantsimplefrenchvegetariancrispycreamyfluffydate-night

Ingredients

  • 4 nests store-bought meringue nests
  • 1 cup heavy cream
  • 2 tbsp powdered sugar
  • ½ tsp vanilla extract
  • 1 lb fresh strawberries
  • ½ cup fresh blueberries

Instructions

  1. 1

    Pour heavy cream into a bowl. Whip with a mixer or by hand until soft peaks form, about 2 minutes.

  2. 2

    Fold in powdered sugar and vanilla extract until the cream is fluffy and smooth.

  3. 3

    Hull and halve the strawberries. Leave blueberries whole.

  4. 4

    Spoon whipped cream into each meringue nest, filling generously.

  5. 5

    Top each nest with strawberry halves and blueberries, pressing gently into the cream.

  6. 6

    Serve immediately or chill up to 2 hours.

Tools you’ll need

  • mixing bowl
  • electric mixer or whisk
  • chef's knife
  • cutting board
  • small spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.