5-Min Berry Pavlova Nests
No-bake pavlova shells with whipped cream and fresh berries—ready in minutes. Crispy meringue nests that feel fancy but require zero baking.
- Total time
- 5 min
- Servings
- 4
- Calories
- 245
- Protein
- 2g
elegantsimplefrenchvegetariancrispycreamyfluffydate-night
Ingredients
- 4 nests store-bought meringue nests
- 1 cup heavy cream
- 2 tbsp powdered sugar
- ½ tsp vanilla extract
- 1 lb fresh strawberries
- ½ cup fresh blueberries
Instructions
- 1
Pour heavy cream into a bowl. Whip with a mixer or by hand until soft peaks form, about 2 minutes.
- 2
Fold in powdered sugar and vanilla extract until the cream is fluffy and smooth.
- 3
Hull and halve the strawberries. Leave blueberries whole.
- 4
Spoon whipped cream into each meringue nest, filling generously.
- 5
Top each nest with strawberry halves and blueberries, pressing gently into the cream.
- 6
Serve immediately or chill up to 2 hours.
Tools you’ll need
- mixing bowl
- electric mixer or whisk
- chef's knife
- cutting board
- small spoon
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
