CookSnap is coming soon — Join the waitlist →
Back to recipes

30-Min Lamb Ragù Pasta

Ground lamb simmered with tomato, wine, and aromatics into a rich, savory sauce that coats pasta in under 30 minutes. Skip the classical 3-hour braise — this weeknight version hits all the depth without the wait.

Total time
30 min
Servings
2
Calories
680
Protein
42g
30-Min Lamb Ragù Pasta
comfortitalianlambtendercreamyweeknightdinnerpasta

Ingredients

  • ½ lb ground lamb
  • ½ medium, finely diced yellow onion
  • 14 oz (1 can) canned crushed tomatoes
  • ½ cup red wine
  • 2 tbsp tomato paste
  • 1 tsp dried oregano
  • 8 oz pappardelle or rigatoni pasta
  • ¼ cup, torn fresh basil

Instructions

  1. 1

    Bring a large pot of salted water to a boil for pasta.

  2. 2

    Heat 2 tbsp olive oil in a heavy skillet over medium-high until shimmering, about 90 seconds.

  3. 3

    Add diced onion and cook, stirring occasionally, until softened and translucent, about 4 minutes.

  4. 4

    Add ground lamb, breaking it up with a spoon, and cook until no pink remains, about 5 minutes.

  5. 5

    Stir in tomato paste and oregano, cook 1 minute until fragrant, then pour in wine and scrape up browned bits.

  6. 6

    Add crushed tomatoes and a pinch each of salt and pepper; simmer 10 minutes, stirring occasionally, until sauce thickens.

  7. 7

    While sauce simmers, add pasta to boiling water and cook until al dente per package directions, about 9 minutes.

  8. 8

    Reserve 1 cup pasta water, then drain pasta and toss with ragù, adding pasta water 1/4 cup at a time to loosen if needed.

  9. 9

    Divide between bowls, top with fresh basil, a crack of black pepper, and a drizzle of olive oil.

Tools you’ll need

  • large pot
  • 12-inch heavy skillet
  • wooden spoon
  • colander

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.