CookSnap is coming soon — Join the waitlist →

3-Ingredient Nutella Cookies

Ridiculously simple chocolate-hazelnut cookies made with just Nutella, an egg, and flour. Chewy centers with crispy edges, ready in under 20 minutes.

Total time
18 min
Servings
12
Calories
156
Protein
3g
3-Ingredient Nutella Cookies
simpleindulgentitalianvegetarianchewycrispydessertsnack

Ingredients

  • 1 cup Nutella (or hazelnut-chocolate spread)
  • 1 whole large egg
  • ½ cup all-purpose flour

Instructions

  1. 1

    Set the oven to 350°F and wait until the indicator light or beep tells you it has finished heating, about 10 minutes.

  2. 2

    Line a baking sheet with parchment paper by laying a sheet of parchment across the entire surface and pressing it flat.

  3. 3

    Pour 1 cup Nutella into a medium mixing bowl and break the egg into the bowl on top of the Nutella.

  4. 4

    Use a fork to beat the egg and Nutella together, stirring in the same direction for about 30 seconds until the mixture is uniform and no egg-white streaks remain.

  5. 5

    Add 0.5 cup flour to the bowl and stir with the fork until you see no dry flour specks, about 20 seconds; the batter will be thick and glossy.

  6. 6

    Drop rounded tablespoon-sized portions of batter onto the parchment paper, spacing them about 2 inches apart—you should have roughly 12 cookies.

  7. 7

    Slide the baking sheet into the preheated oven and bake for 8 to 10 minutes, until the edges look set and slightly darker than the center but the top still appears a little soft.

  8. 8

    Remove the baking sheet from the oven using an oven mitt and set it on a heat-safe surface to cool for 5 minutes—the cookies will firm up as they cool.

  9. 9

    Once cool enough to touch, use a wide metal spatula to lift each cookie from the parchment and transfer to a serving plate or cooling rack.

Tools you’ll need

  • oven
  • baking sheet
  • parchment paper
  • medium mixing bowl
  • fork
  • oven mitt
  • wide metal spatula
  • serving plate or cooling rack

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.