CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Rendang Beef

Coconut-rich, spice-forward beef curry that tastes like the real thing—minus the 3-hour simmer. Rendered down in one skillet with a shortcut rendang paste and tender ground beef.

Total time
20 min
Servings
2
Calories
520
Protein
32g
Rendang Beef
comfortboldindonesianbeeftendercreamyweeknightdate-night

Ingredients

  • 1 lb ground beef
  • 3 tbsp rendang paste (jarred)
  • 1 can (13.5 oz) coconut milk (canned, full-fat)
  • 1 whole (juiced) lime
  • ¼ cup fresh cilantro (chopped)
  • ¼ cup sliced shallots or red onion (optional garnish)

Instructions

  1. 1

    Heat oil in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  2. 2

    Brown ground beef, breaking it up with a spoon, until no pink remains and it starts to caramelize, about 6 minutes.

  3. 3

    Stir in rendang paste until the beef is fully coated and fragrant, about 1 minute.

  4. 4

    Pour in coconut milk and bring to a gentle simmer, stirring occasionally, for 8 minutes until the sauce thickens and deepens in color.

  5. 5

    Squeeze lime juice over the top and taste, adjusting salt as needed.

  6. 6

    Serve over rice, garnished with cilantro and shallots if desired.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.