CookSnap is coming soon — Join the waitlist →
Back to recipes

20-Min Shrimp Soup with Crispy Croutons

A quick, warming Mexican-style shrimp broth loaded with tender shrimp and finished with garlicky croutons. Ready in 20 minutes with just six ingredients.

Total time
20 min
Servings
2
Calories
285
Protein
32g
20-Min Shrimp Soup with Crispy Croutons
comfortquickmexicanshrimptendercrispyweeknightsoup

Ingredients

  • 1 lb shrimp, peeled and deveined
  • 6 cups chicken or seafood broth
  • 2 tbsp tomato paste
  • 1 whole jalapeño, sliced
  • 1 whole lime (juiced)
  • 2 cups crusty bread, cubed for croutons

Instructions

  1. 1

    Heat 1 tbsp oil in a large pot over medium-high heat. Add bread cubes and toss until golden and crispy, about 4 minutes. Transfer to a plate.

  2. 2

    Add broth and tomato paste to the same pot. Stir until smooth, then add jalapeño slices and a pinch of salt.

  3. 3

    Bring to a boil, then slide in the shrimp. Simmer until shrimp turn pink and opaque throughout, about 4 minutes.

  4. 4

    Squeeze lime juice into the pot. Taste and adjust salt and pepper as needed.

  5. 5

    Ladle soup into bowls and top generously with crispy croutons. Serve immediately.

Tools you’ll need

  • large pot (4-quart or larger)
  • wooden spoon
  • ladle
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.