CookSnap is coming soon — Join the waitlist →
Back to recipes

15-Min Onigiri Rice Balls

Warm sushi rice shaped into triangles with crispy nori, umeboshi, and sesame. A Japanese lunchbox staple that's faster than delivery and twice as satisfying.

Total time
15 min
Servings
2
Calories
210
Protein
4g
15-Min Onigiri Rice Balls
simplewholesomejapanesevegetarianvegancrispytenderweeknight

Ingredients

  • 2 cups cooked sushi rice, warm
  • 2 sheets nori (seaweed sheets)
  • 1 tbsp umeboshi (pickled plum) or furikake
  • 1 tbsp sesame seeds (white or black)
  • ¼ tsp salt

Instructions

  1. 1

    Wet your hands with water and sprinkle salt on your palms to prevent sticking.

  2. 2

    Scoop 1/2 cup warm rice into your palm, flatten it slightly, and press umeboshi or a pinch of furikake into the center.

  3. 3

    Cover with another 1/4 cup rice and gently shape into a triangle, compressing until firm but not dense.

  4. 4

    Wrap the nori strip around the base. Repeat with remaining rice to make 4 onigiri total.

  5. 5

    Sprinkle sesame seeds over the top of each onigiri.

  6. 6

    Serve immediately or wrap individually in plastic wrap for lunch.

Tools you’ll need

  • shallow bowl for water
  • hands (primary tool)
  • cutting board (optional, for assembly)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.

Craving more? Browse all Japanese recipes →