CookSnap is in beta — Get it free on TestFlight →
Back to recipes

10-Minute Zaru Soba

Chilled buckwheat noodles with a punchy dipping sauce of soy, mirin, and dashi. Served with fresh toppings—crispy and refreshing in under 10 minutes.

Total time
10 min
Servings
2
Calories
320
Protein
11g
10-Minute Zaru Soba
lightrefreshingjapanesevegetarianvegetarianchewytenderweeknight

Ingredients

  • ¼ cup soy sauce
  • 2 tbsp mirin (sweet rice wine)
  • ¼ cup dashi stock (or instant dashi powder mixed with water)
  • 200 g dried soba noodles
  • ½ whole cucumber
  • ½ sheet nori (seaweed sheet), optional

Instructions

  1. 1

    Combine soy sauce, mirin, and dashi in a small bowl. Stir until mirin dissolves. Set aside.

  2. 2

    Boil salted water in a large pot. Add soba noodles and cook until just tender, about 4 minutes.

  3. 3

    Drain noodles in a fine-mesh strainer and rinse under ice-cold running water until completely chilled.

  4. 4

    Slice cucumber into thin matchsticks. If using nori, cut into thin strips.

  5. 5

    Divide noodles between two plates or bamboo mats. Top with cucumber and nori.

  6. 6

    Pour dipping sauce into two small bowls. Dip noodles into sauce with each bite.

Tools you’ll need

  • large pot
  • fine-mesh strainer
  • small mixing bowl
  • two small dipping bowls
  • cutting board
  • sharp knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.