10-Minute Pizza Toast Bites
Crispy bread topped with melty cheese, pepperoni, and fresh tomato, broiled until bubbly. Serve with a side salad, fries, and roasted chili peppers for a complete snack board.
- Total time
- 10 min
- Servings
- 2
- Calories
- 380
- Protein
- 18g
quickcasualitalianvegetariancheesecrispymeltysnack
Ingredients
- 8 slices bread (baguette or ciabatta), sliced 1/2-inch thick
- 1 cup mozzarella cheese, shredded
- ½ cup pepperoni, sliced thin
- ½ cup cherry tomatoes, halved
- 2 tbsp olive oil
- ¼ cup fresh basil (optional)
Instructions
- 1
Place bread slices on a broiler pan. Brush lightly with olive oil on both sides.
- 2
Broil bread 3-4 inches from heat for 90 seconds per side until golden and crispy.
- 3
Top each slice with mozzarella, pepperoni, and cherry tomato halves.
- 4
Broil again for 2-3 minutes until cheese bubbles and edges brown slightly.
- 5
Scatter fresh basil on top if using. Serve immediately with side salad and fries.
Tools you’ll need
- broiler pan or baking sheet
- toaster or oven broiler
- knife
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
