CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Koshari Bowl

Layered pasta, lentils, and chickpeas topped with crispy onions and tangy tomato sauce. A Cairo street-food classic that comes together in one skillet.

Total time
25 min
Servings
2
Calories
520
Protein
18g
Koshari Bowl
comfortcasualmiddle-easternvegetarianveganlentilschickpeascrispy

Ingredients

  • 1 cup short pasta (ditalini or elbow)
  • 1 can (15 oz) canned lentils, drained
  • 1 can (15 oz) canned chickpeas, drained
  • 1 large yellow onion, thinly sliced
  • 1 can (15 oz) canned crushed tomatoes
  • 3 tbsp red vinegar (or white vinegar)
  • 2 cloves garlic, minced
  • ½ tsp chili powder or cayenne pepper

Instructions

  1. 1

    Boil pasta in salted water until al dente, about 8 minutes. Drain and set aside.

  2. 2

    Heat 3 tbsp olive oil in a large skillet over medium-high. Add sliced onion and cook, stirring occasionally, until golden and crispy, 6–8 minutes. Transfer to a plate.

  3. 3

    In the same skillet, add minced garlic and cook for 30 seconds until fragrant. Add crushed tomatoes, vinegar, and chili powder. Stir and simmer for 3 minutes.

  4. 4

    Add lentils and chickpeas to the sauce. Warm through, stirring gently, for 2 minutes. Season with salt and pepper to taste.

  5. 5

    Divide cooked pasta between two bowls. Spoon lentil-chickpea mixture over top, then pile crispy onions high on each.

  6. 6

    Serve hot with extra vinegar on the side if desired.

Tools you’ll need

  • large pot
  • large skillet (12-inch)
  • colander
  • wooden spoon
  • two bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.