CookSnap is coming soon — Join the waitlist →
Back to recipes

Biryani Rice Bowl

Layered jasmine rice, fragrant spices, and mixed protein in one skillet — no long braise needed. Golden, aromatic, and done before dinner time.

Total time
20 min
Servings
2
Calories
480
Protein
24g
Biryani Rice Bowl
comfortsatisfyingmalaysianchickenshrimpfluffytenderweeknight

Ingredients

  • 2 cups cooked jasmine rice (about 2 cups, day-old preferred)
  • 150 g boneless chicken thigh, sliced thin
  • 100 g shrimp, peeled
  • ½ medium yellow onion, sliced thin
  • 1 tbsp biryani spice blend (or garam masala + cumin + clove)
  • ¼ cup coconut milk
  • 1 whole lime (juiced)
  • ¼ cup fresh cilantro, chopped

Instructions

  1. 1

    Heat 2 tbsp oil in a 12-inch skillet over medium-high heat until shimmering, about 60 seconds.

  2. 2

    Cook onion, stirring, until edges begin to turn golden, 2–3 minutes. Scatter the biryani spice over and stir for 30 seconds until fragrant.

  3. 3

    Add chicken and shrimp, breaking them apart. Cook without stirring for 90 seconds, then toss and cook until chicken is opaque, 2 minutes total.

  4. 4

    Stir in cooked rice, coconut milk, and a pinch of salt. Fold gently until combined and heated through, about 2 minutes.

  5. 5

    Pour lime juice over the top. Fold once and taste for seasoning.

  6. 6

    Divide into bowls and garnish with fresh cilantro. Serve hot.

Tools you’ll need

  • 12-inch skillet
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.